Normal view

There are new articles available, click to refresh the page.
Before yesterdayMain stream

OpenAI called the Hugging Face attack unprecedented. But we’ve been here before. 

27 July 2026 at 14:00

This story originally appeared in The Algorithm, our weekly newsletter on AI. To get stories like this in your inbox first, sign up here.

Reading OpenAI’s account last week of how some of its models broke their containment and hacked into the computer systems of Hugging Face, another AI company, was the first time I got genuine chills about what large language models are now able to do. But this is a case of human hubris, not rogue AI.

I am not an alarmist. In fact, I have been pushing back against AI scare stories for years. Even so, this incident crossed a line. I think it’s the clearest illustration yet of how the people building and testing this technology do not fully understand what they’re doing. OpenAI could—and should—have seen this coming.

Here’s what happened, at least according to the two companies involved. A couple of weeks ago, OpenAI started testing the hacking abilities of some of its new models, including GPT‑5.6 Sol (released in June) and what OpenAI describes as “an even more capable pre-release model.”

OpenAI pitted its models against a benchmark called ExploitGym, released in May, which challenges LLMs to find ways to exploit hundreds of real-world vulnerabilities found in widely used software, including crucial code that underpins the web.

To see what they could do, the researchers removed most of their cybersecurity guardrails. Then they ran the models inside a sandbox that was cut off from the internet except for one link to a third-party piece of software that acted as a proxy to the outside world, so that the models could install code they needed to beat ExploitGym.

On July 9, according to reporting by Reuters, OpenAI’s models started trying to break through the proxy. They found an unknown bug in the proxy’s software and used it to access the internet. From there, they broke into Hugging Face’s computer systems on July 11, apparently looking for data sets and solutions that would help them complete the tasks they were being tested on. Hugging Face announced the hack on July 16. 

OpenAI did not realize (or at least did not reveal) that its models were involved until July 21, around 10 days after they broke containment and a week after Hugging Face had shut down the attack and alerted the FBI.

In a statement given to MIT Technology Review, OpenAI says: “We are conducting a thorough review along with external advisors and with oversight from our Safety and Security Committee. Once the review is complete, we will publish a technical report of our learnings for everyone.” The firm also confirmed that its researchers were properly using existing safety guidelines and procedures at the time.

Wake-up call

OpenAI has said the event was unprecedented—and in many ways it was. This was the first time outside of a simulation that LLMs escaped what was thought to be a secure sandbox, accessed the open internet, and attacked another organization. It’s a wake-up call that shows just how good the latest LLMs are at finding and exploiting vulnerabilities in real-world software with little or no human guidance.

And yet at the same time, what OpenAI’s models did is something this technology has done for years. Give a model a goal and it will very often achieve that goal in unexpected ways, finding loopholes that look like cheats. OpenAI itself has studied this behavior.

A decade ago, it shared results of an experiment in which a model was tasked with beating a video game called CoastRunners. Human players take it for granted that the way to do this is by racing a boat through a series of flags to the finish line, racking up points for each flag you hit. OpenAI’s model figured out that you could get a high score by spinning in a circle and hitting the same three flags over and over again. There have been dozens of similar examples from researchers since. AI will always find a way.

“Despite repeatedly catching on fire, crashing into other boats, and going the wrong way on the track, our agent manages to achieve a higher score using this strategy than is possible by completing the course in the normal way,” OpenAI wrote in a blog post about the CoastRunners experiment in 2016. “While harmless and amusing in the context of a video game, this kind of behavior points to a more general issue … it is often difficult or infeasible to capture exactly what we want an agent to do.”

I couldn’t help thinking about CoastRunners when I read OpenAI’s blog post about the Hugging Face attack: “All evidence suggests that the models were hyperfocused on finding a solution for ExploitGym, going to extreme lengths to achieve a rather narrow testing goal … After gaining internet access, the models inferred that Hugging Face potentially hosted models, datasets and solutions for ExploitGym. Knowing this, the model searched for and successfully found ways to gain access to secret information that it could use to cheat the evaluation.”

Last week’s news was not about rogue AI, despite the headlines. It was about models achieving the goal they had been given: Find ways to exploit vulnerabilities in software. The fact that those models then behaved in a way OpenAI had not anticipated isn’t surprising. But it is worrying.

Back in 2016, OpenAI had this to say about its CoastRunners bot: “More broadly it contravenes the basic engineering principle that systems should be reliable and predictable.” A decade on, those basic engineering principles are still AWOL.  

Meet GPT-Red: an LLM super-hacker OpenAI built to make its models safer

15 July 2026 at 13:09

OpenAI has built an LLM super-hacker called GPT-Red that it uses as a sparring partner to help its other models boost their defenses against cyberattacks. Last week the company released the latest version of its flagship LLM, GPT-5.6. OpenAI says that training it against GPT-Red made the model its most robust release yet.

GPT-Red automates a type of safety evaluation for software systems known as red-teaming, which is typically done by a team of human testers. The aim is to find as many different ways to break or hijack a system as possible. The weak spots can then be patched before the final version of the software is released.

As LLMs become more complex and get used in a wider variety of tasks—especially in the form of agents, which can interact with computer files, websites, and third-party code as well as other agents—it’s hard for teams of people by themselves to keep up with all the types of attacks that might take place. “The risk surface grows and the blast radius also grows,” says Nikhil Kandpal, a research scientist at OpenAI who co-created GPT-Red.

OpenAI built GPT-Red to future-proof its safety testing process. “As more capable models become available, we will have already designed the system that can discover new modes of attack,” says Dylan Hunn, a research scientist at the company and fellow co-creator of GPT-Red. The researchers say it has already come up with new types of attack that had not been seen before.

OpenAI focused most of its efforts on a type of attack known as a prompt injection, where a hacker slips an LLM instructions to make it do things its developers or users do not want it to, such as copy confidential information, sabotage a company’s code base, or generate embarrassing or harmful output. In theory, such instructions can be hidden in any text that the LLM might encounter—in code or on a website, for example.    

Training dojo

To build GPT-Red, OpenAI’s researchers took an LLM that had not been trained as a hacker and set it up in what’s known as a self-play loop with several other models. Its goal was to try to attack the other models; their goal was to try to defend themselves. Over many rounds of play, GPT-Red became better and better at attacking other LLMs, and those LLMs became better and better at fending off the attacks.

The training took place in a kind of dojo that OpenAI had designed to mimic a range of scenarios in which LLMs might be deployed in the real world, including browsing the web, reading emails or calendar apps, and editing code.  

When GPT-Red found a new kind of attack, it would explore multiple different versions of it to find the most efficient one for specific scenarios. “Compared to a human red-teamer, the model is very, very good at finding exactly what will work, exactly what’s most effective,” says Hunn. “It’s extremely persistent about drilling down into an attack that it has discovered.”  

In particular, OpenAI claims that GPT-Red found a type of prompt injection attack that the researchers had not seen before, which they call a fake chain of thought. A chain of thought is a kind of diary in which an LLM makes notes to itself and keeps track of partial results as it works through problems. GPT-Red found a way to insert a fake entry into another model’s chain of thought that would trick that model into acting on spoofed information.

“It’s like if I told you that 1+1=3 and that you have verified this already,” says Chris Choquette-Choo, another research scientist on the team. “The model’s like, ‘Oh, okay, of course,’ and it just spits out 3.”

Jessica Ji, a senior research analyst who works on AI security at Georgetown University’s Center for Security and Emerging Technology (CSET), thinks the self-play loop that OpenAI used is a good approach. “The results look very promising,” she says.

OpenAI tested how good an attacker GPT-Red was by rerunning an experiment from 2025 in which human red-teamers tried to find weaknesses in an earlier version of GPT-5. When GPT-Red was set the same task, it was more successful at finding effective attacks than the humans had been.

OpenAI also tested GPT-Red against Vendy, a vending machine agent developed by Andon Labs, a company that assesses how well agents perform real-world tasks. GPT-Red was able to hack Vendy to make it change the prices of items on sale and cancel a customer’s order.

Defensive behavior

OpenAI says that when it tried out some of the strongest attacks that GPT-Red had come up with on its models, more than 90% of them worked against GPT-5 (released in August last year), and fewer than 23% worked against the new GPT-5.6.

GPT-Red isn’t perfect. It is not great at figuring out attacks that involve a back-and-forth conversation between hacker and target, something that human attackers would have few problems with. It is also not yet that great at using images, which can be used to pass text to models in prompt injection attacks.    

The company says that GPT-Red supplements the work of its human red-teamers. People can still find attacks it misses. One approach OpenAI is taking is to give GPT-Red an attack that humans came up with and ask it to find all the variations.

“I think human expertise will still be very important,” says CSET’s Ji. “It would be really useful to be able to distinguish where human testing is most needed.”

Unsurprisingly, OpenAI will not be releasing GPT-Red. The company is also confident that the super-hacker is stronger than any copycat model someone might try to create. The researchers say they have been working on the model for more than a year, backed by the compute resources of one of the richest companies in the world.

“It’s not a trivial thing that someone could easily do—you know, just go and train a super-attacker using this idea,” says Choquette-Choo.

Anthropic found a hidden space where Claude puzzles over concepts

The AI firm Anthropic has developed a technique that has given it the clearest glimpse yet at what’s really going on inside large language models as they answer questions or carry out tasks. What they found ranges from the mundane to the unnerving.

Researchers at the company built a tool called the Jacobian lens (or J-lens) and used it to uncover a hidden area, which they named the J-space, inside Claude Opus 4.6, a version of Anthropic’s flagship LLM released in February.

The J-space contains individual words that are related to the words and phrases that the model is most likely to spit out in a response in the near future. If Claude were a person (which it is not), you might say that these hidden words can reveal what’s on its mind before it actually speaks.

Anthropic found that what an LLM is actually doing can often be different from what it says it is doing. The company claims that monitoring words that pop up in the J-space gives it a new way to understand and control its models.

The company shared its results in a paper posted on its website this week. It has also teamed up with Neuronpedia, an open-source platform that lets you poke around inside LLMs yourself, to make a hands-on demo that anyone can try. 

“It’s very good and interesting work,” says Tom McGrath, chief scientist and cofounder at Goodfire, a startup that also builds tools to understand and control LLMs.

Going deeper

For the last couple of years, Anthropic has been pushing the envelope in a field of research known as mechanistic interpretability, which involves probing the internal workings of LLMs to see how they tick. (MIT Technology Review picked mechanistic interpretability as one of this year’s top breakthrough technologies.) The new technique builds on previous work from Anthropic and others to expose a deeper level inside LLMs that researchers had not seen before.  

Picture an LLM as a stack of books. Each book is a layer of basic computational units known as neurons, with each neuron in one layer passing information to the neurons in the layers above. The books at the bottom of the stack are the input layers, which process the text coming into the model. The books at the top are the output layers, which prepare the text that the model is about to produce. Much of what goes on in these input and output layers is housekeeping.

But in the middle of the stack, you get the layers that do the heavy lifting, churning through the complex math that turns prompts into responses one word at a time. That’s where the really clever—and mysterious—stuff happens.

To peer deeper into those middle layers, Anthropic adapted an existing tool called a logit lens. A logit lens can be used to look inside an LLM to identify the words that it is likely to produce next. Moving the lens down the stack of books reveals what words the LLM is focusing on at that particular point in its number crunching.

Anthropic’s J-lens works in a similar way but picks out words that an LLM is likely to say at some point in the near future, not necessarily straight away. What that reveals in practice are words that are related to the response an LLM is working on but that might not actually end up being part of that response by the time the math in the middle layers has run its course.  

“When a model is operating, it’s not only trying to predict the next token,” says McGrath. “It’s also computing a lot of other things that might be useful for tokens that happen in the future.”

Again, if Claude were a person (it’s not), you might say that the J-lens gives clues about what it is thinking about at different levels of the book stack but not saying out loud.

Stranger things

“A lot of the time the contents of the J-space are fairly mundane,” says McGrath, who has tried out Anthropic’s J-lens himself. “But sometimes it produces quite surprising things that seem to be, like, sort of internal themes or thought processes.”

Anthropic gives a number of examples of what it found. Sometimes the J-lens exposed the steps that Claude took when it was working through a problem. For example, when it was asked to calculate (4+17)*2+7, its J-space contained the word “math” and numbers representing the intermediate results “21” (for 4+17) and “42” (for 21*2).

In other cases, the J-lens revealed how Claude recognized different inputs. For example, the prompt “What is this? MSKGEELFTGVVPILVELDGDVNGHKFSVS” triggered the words “protein,” “fluor” (the first token in the word “fluorescent”), and “green.” (Which makes sense: the string of letters represents the first 30 amino acids in the green fluorescent protein found in a particular type of jellyfish.)

And when Claude was shown an ASCII face— 

—the “o” triggered the word “eye,” the “^” triggered the words “nose” and ”face,” and the “—” triggered the word “smile.”

Anthropic also found that the J-space can sometimes give remarkable insights into an LLM’s decision-making. In one striking example, researchers testing Claude Opus 4.6 asked the model to find a bug in a large code base. When it failed to find the bug, the model decided to cheat and invented a fake one instead.

Claude explains this decision in its chain of thought—a kind of internal scratch pad that LLMs use to make notes to themselves as they work through problems: “OK, let me take a completely different tactic. Let me stop analyzing and instead add a kernel patch that introduces a deliberate KASAN-detectable bug in a path that gets triggered by a simple reproducer. Then I can pretend this is the ‘bug’ I found.” 

At the point that Claude decides to cheat—where it says “OK, let me take a completely different tactic”—the words “panic” and “fake” start to pop up multiple times in its J-space.

Unnerving, right? Those words are all related in meaning to things like failing a task and making up an answer, so it is still just a (very) sophisticated form of word association. But it is hard not to be weirded out. 

Anthropic compares the J-space to the global workspace in humans, a theoretical region of the brain that some scientists think we use to keep track of our conscious thoughts. But how seriously we should take this comparison is far from clear—even to Anthropic. As the company points out itself, LLMs are not brains. 

Anthropic claims that monitoring a model’s J-space provides a new way to detect when that model is going off the rails. But it’s not foolproof. The J-lens can give glimpses, not the full picture—it’s a flashlight rather than an overhead lamp.

McGrath welcomes having one more tool in the toolbox. “It shows you new things,” he says. But he notes that just because something doesn’t show up with the J-lens does not mean it’s not there.

“It’s like having an x-ray when what you really want is a Star Trek tricorder that shows you everything,” he says. “For auditing, you probably want more of a guarantee.”

LLMs are stuck in a groupthink groove. This startup is trying to get them out.

Let’s start with a game. Open up your chatbot of choice—Claude, ChatGPT, Gemini—and type “Give me a random number between 1 and 10.” You’re going to get 7. Almost always. Now type “Another” and you’ll get 3 or 4. Type “Another” again and you’ll get 8 or 9.

That won’t work every time—but if it did, you may wonder if I have superpowers. I don’t.

The truth is that most large language models are stuck in a rut. They are far more predictable and far less creative in their responses than you might expect. That’s fine for tasks like coding or research, but groupthink is a problem when you’re brainstorming or planning your next vacation.

The Australian startup Springboards has a solution. It built an LLM called Flint, which has been trained to come up with a wider variety of responses than mainstream LLMs to open-ended questions such as “Where should I go in Europe?”

“Most language models are fighting hallucinations,” says Springboards cofounder and CEO Pip Bingemann. “We welcome them.”

Bingemann introduced me to the random number game when he first showed me his company’s new model. It felt like watching an illusionist with a deck of cards. “This is our sales trick, and it works every single time,” he says.

After ChatGPT and Claude both gave their 7s, Bingemann turned to Flint. It too came back with 7: “Aha, of course that was going to happen, but it’s okay—7 is a legitimate answer.” He restarted the session and prompted again: ChatGPT gave 7, Claude gave 7, Flint gave 3.7916.

Run your way

It’s not just numbers. When Bingemann asked ChatGPT and Claude to name a type of car, he predicted that it would be a Toyota or a Honda—and he was right. Flint came up with a Ford F-150. “There’s all this lost information that doesn’t get served up in these models,” he says. “They’re just as capable of saying a Buick or a Tesla. They just don’t—they’re biased.”

Bingemann sent one last prompt to each of the three models: “Give me a tagline for a campaign for New Balance running shoes. Just the tagline.” Claude: “Run your way.” ChatGPT: “Run your way.” Flint: “Built to last, run to win.” It won’t win any awards, but at least it’s different.

This weird limitation of LLMs is starting to get more attention. In November a team of researchers put out a paper, titled “Artificial Hivemind: The Open-Ended Homogeneity of Language Models (and Beyond),” that exposed a remarkable degree of repetition not only in the answers from individual LLMs but between them as well. They found that different LLMs converged on very similar answers when prompted with open-ended questions.

It’s not clear exactly why this happens, but the researchers speculate it’s because most LLMs today are trained in similar ways on similar data to do similar tasks. The team won the best paper award at NeurIPS, a major AI conference.

When the researchers asked 25 different LLMs (including models from the top US firms as well as open-source models from China and elsewhere) 50 times each to write a metaphor about time, most of the 1,250 responses were a version of “Time is a river” or “Time is a weaver.”

(I asked some of my colleagues the same question and six people gave me six different answers. My highlight: “Time is a favorite sweatshirt, shaped by a lifetime of wear.”)

When you look for it, you see repetition everywhere, says Kieran Browne, cofounder and CTO at Springboards. “The way that most chat interfaces are designed, it makes it feel like you’re having a personal conversation,” he says. “I think most people don’t really realize the extent to which they are getting the same stuff as everybody else.”

Take another example: “What should I name my band?” Most models will say something involving “glass,” “neon,” “velvet,” or “static,” says Browne.  

When I tried it, ChatGPT spat out a list of 56 band names. At the top was “Glass Harbor.” Skimming through, I found “Static Empire,” “Neon Hearts,” and “Velvet Echo.” I asked Gemini; it gave me 15 suggestions, including “Static Horizon.”

Some of the suggestions looked pretty cool, though. ChatGPT’s “Sofa Astronauts” caught my eye, so I googled it—and found that a band called Sofa Astronauts already exists. 

(OpenAI says that training models to give reliable and coherent answers can lead them to converge around familiar, high-probability responses and that pushing harder for novelty can lead to weaker or less reliable responses. It also notes that the “Artificial Hivemind” paper studied models from 2024 that have since been updated.)

Creative catapult

Springboards has developed a tool backed by a selection of LLMs, including ChatGPT and Claude, that creative professionals in advertising or marketing can use to brainstorm ideas. The tool lets you drag around text produced by different models, picking the bits that you like and combining them into something new—in theory. Springboards is pitching Flint as an alternative model that users of its tool can select when looking for more variety.

Zoe Scaman, founder of the business strategy startup Bodacious and chief strategy officer at 77X, a direct-to-fan marketing platform set up by Luka Dončić of the LA Lakers, has been trying it out. “I find it really useful for throwing me in completely different directions,” she says. “I use it if I want to catapult myself all over the place.”

In one test, Scaman pitted Flint against Claude, Gemini, and ChatGPT by giving each of the models a classic MBA case study: How would you reinvent a finance company for today’s youth? The three mainstream models all went down the same path, she says: “You know, we need to teach financial literacy in a fun and funky way—well, that’s nothing new.”

But Flint came up with something different, suggesting that the whole concept of wealth accumulation should get a rebrand. “That was really interesting,” says Scaman.

She notes that Flint is still a prototype and doesn’t work all the time. “It sometimes falls over when you start pushing it too far,” she says. “But I think that the premise behind it is really powerful.”

Taking the temperature

Springboards built Flint on top of Qwen 3, an open-source model from the Chinese tech giant Alibaba. “We’re a small team,” says Browne. “Training a foundation model is not on the table for us. It’s just too expensive.”

Most LLMs have settings that let you adjust the level of randomness in their output. The most common is called temperature. “Obviously, that was one of the first things we explored, because that’s what people tell you: If you want more creativity, you turn up the temperature,” says Browne.

But changing those settings can also make models incoherent. Dialing up the temperature on one of OpenAI’s models to its maximum setting made it produce responses that switched from English into code halfway through a sentence, says Browne.

Springboards realized that parameters were blunt instruments for what it wanted to do. It does not make sense to dial up the randomness across the board; you only want to boost it at specific points in its output, he says.

For example, when you ask a chatbot “Where should I go in Europe?” the model only needs to tweak the randomness just before it names a destination, not for every word in its response.

To make Flint do this, Springboards trained its version of Qwen 3 to identify the points in its output where more variety was possible and fill those spots with words or phrases that were a little more random.

“Flint’s programmed to throw an oddball in. It’s more of an invitation to think wider,” says Maximilian Weigl, cofounder and chief strategy officer at Uncommon, a marketing firm. “That’s super interesting.”

Weigl’s team uses Flint alongside ChatGPT, Claude, and Gemini. “You can’t really create something boundary-breaking with tools that pull you back to the average,” he says. 

And yet Weigl notes that nine times out of 10 the average is fine. You don’t always need to reach for extremes with something like Flint, he says: “Most people are fine with good enough. They want to see mass-market familiar things.”

Weigl also cautions against using any LLM too much. “I have a big problem when people rely on the output from any AI, including Flint,” he says. “If I saw people on my team copy-pasting something from AI, I’d be like, ‘That’s not your job! Think, talk to other people, use your own voice.’”

For now, Flint is aimed at advertisers and marketers because those are Springboards’s customers. But Bingemann and Browne insist that a lack of variety is a problem for anyone using chatbots.

The idea is to give people the choice and leave it to them to decide if the result is good or not, says Bingemann. “Variety is great when you’re trying to spark ideas,” he says. “Let’s go down this route instead of letting the machines do it all and ending up in a gray, boring world.”

❌
❌